PDB entry 1cku

View 1cku on RCSB PDB site
Description: ab initio solution and refinement of two high potential iron protein structures at atomic resolution
Deposited on 1999-04-24, released 1999-05-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-24, with a file datestamp of 1999-11-23.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.128
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ckua_
  • Chain 'B':
    Domains in SCOP 1.55: d1ckub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ckuA (A:)
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ckuB (B:)
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag