Lineage for d1ckua_ (1cku A:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) 
Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) Protein HIPIP (high potential iron protein) [57654] (6 species) Species Chromatium vinosum [TaxId:1049] [57656] (7 PDB entries) 
Domain d1ckua_: 1cku A: [44981]
Details for d1ckua_
PDB Entry: 1cku (more details), 1.2 Å
PDB Description: ab initio solution and refinement of two high potential iron protein structures at atomic resolution
SCOP Domain Sequences for d1ckua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckua_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Chromatium vinosum}
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag
SCOP Domain Coordinates for d1ckua_:
Click to download the PDB-style file with coordinates for d1ckua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ckua_:
- d1ckua_ appears in SCOP 1.57
- d1ckua_ appears in the current release, SCOPe 2.08
View in 3D
