PDB entry 1a6x

View 1a6x on RCSB PDB site
Description: structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures
Deposited on 1998-03-04, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: NMR49
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1a6x__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a6x_ (-)
  meapaaaeisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqiea
  dksgtvkailvesgqpvefdeplvvie