PDB entry 155c

View 155c on RCSB PDB site
Description: the structure of paracoccus denitrificans cytochrome c550
Deposited on 1976-08-01, released 1976-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d155c__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >155c_ (-)
    negdaakgekefnkckachmiqapdgtdikggktgpnlygvvgrkiaseegfkygegile
    vaeknpdltwteanlieyvtdpkplvkkmtddkgaktkmtfkmgknqadvvaflaqddpd
    axxxxxxxxxxxxx