Lineage for d155c__ (155c -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Cytochrome c2 [46650] (7 species) 
Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries) 
Domain d155c__: 155c - [15900]
Details for d155c__
PDB Entry: 155c (more details), 2.5 Å
PDB Description: the structure of paracoccus denitrificans cytochrome c550
SCOP Domain Sequences for d155c__:
Sequence; same for both SEQRES and ATOM records: (download)
>d155c__ a.3.1.1 (-) Cytochrome c2 {Paracoccus denitrificans}
negdaakgekefnkckachmiqapdgtdikggktgpnlygvvgrkiaseegfkygegile
vaeknpdltwteanlieyvtdpkplvkkmtddkgaktkmtfkmgknqadvvaflaqddpd
axxxxxxxxxxxxx
SCOP Domain Coordinates for d155c__:
Click to download the PDB-style file with coordinates for d155c__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d155c__:
- d155c__ appears in SCOP 1.57
- d155c__ appears in the current release, SCOPe 2.08, called d155ca_
View in 3D