Lineage for d1usvb_ (1usv B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203889Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies)
    core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander
  4. 2203905Superfamily d.83.2: Activator of Hsp90 ATPase, Aha1 [103111] (1 family) (S)
    consists of a single domain of this fold
    automatically mapped to Pfam PF09229
  5. 2203906Family d.83.2.1: Activator of Hsp90 ATPase, Aha1 [103112] (1 protein)
  6. 2203907Protein Activator of Hsp90 ATPase, Aha1 [103113] (1 species)
  7. 2203908Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103114] (2 PDB entries)
  8. 2203910Domain d1usvb_: 1usv B: [99888]
    Other proteins in same PDB: d1usva_, d1usvc_, d1usve_, d1usvg_
    complexed with a Hsp90 domain

Details for d1usvb_

PDB Entry: 1usv (more details), 2.7 Å

PDB Description: the structure of the complex between aha1 and hsp90
PDB Compounds: (B:) aha1

SCOPe Domain Sequences for d1usvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usvb_ d.83.2.1 (B:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
wvdkncigwakeyfkqklvgveagsvkdkkyakiksvssiegdcevnqrkgkvislfdlk
itvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplirse
llpklrqifqqfgkdllathgnd

SCOPe Domain Coordinates for d1usvb_:

Click to download the PDB-style file with coordinates for d1usvb_.
(The format of our PDB-style files is described here.)

Timeline for d1usvb_: