Lineage for d1upth_ (1upt H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752997Fold a.193: GRIP domain [101282] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1752998Superfamily a.193.1: GRIP domain [101283] (1 family) (S)
  5. 1752999Family a.193.1.1: GRIP domain [101284] (1 protein)
  6. 1753000Protein Golgi autoantigen, golgin-245 [101285] (1 species)
  7. 1753001Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries)
  8. 1753005Domain d1upth_: 1upt H: [99774]
    Other proteins in same PDB: d1upta_, d1uptc_, d1upte_, d1uptg_
    complexed with gtp, mg

Details for d1upth_

PDB Entry: 1upt (more details), 1.7 Å

PDB Description: structure of a complex of the golgin-245 grip domain with arl1
PDB Compounds: (H:) Golgi autoantigen, golgin subfamily A member 4

SCOPe Domain Sequences for d1upth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upth_ a.193.1.1 (H:) Golgi autoantigen, golgin-245 {Human (Homo sapiens) [TaxId: 9606]}
geptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarl

SCOPe Domain Coordinates for d1upth_:

Click to download the PDB-style file with coordinates for d1upth_.
(The format of our PDB-style files is described here.)

Timeline for d1upth_: