Class a: All alpha proteins [46456] (284 folds) |
Fold a.193: GRIP domain [101282] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.193.1: GRIP domain [101283] (1 family) |
Family a.193.1.1: GRIP domain [101284] (1 protein) |
Protein Golgi autoantigen, golgin-245 [101285] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries) |
Domain d1uptd_: 1upt D: [99770] Other proteins in same PDB: d1upta_, d1uptc_, d1upte_, d1uptg_ complexed with gtp, mg |
PDB Entry: 1upt (more details), 1.7 Å
SCOPe Domain Sequences for d1uptd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uptd_ a.193.1.1 (D:) Golgi autoantigen, golgin-245 {Human (Homo sapiens) [TaxId: 9606]} geptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlm
Timeline for d1uptd_: