SCOPe 2.06: Domain d1umha1: 1umh A:117-297

Lineage for d1umha1 (1umh A:117-297)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
   automatically mapped to Pfam PF04300

6. Protein F-box only protein 2 [101586] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101587] (2 PDB entries)

8. Domain d1umha1: 1umh A:117-297 [99605]
   Other proteins in same PDB: d1umha2
   complexed with ni

Details for d1umha1

PDB Entry: 1umh, 2 Å

PDB Description: Structural basis of sugar-recognizing ubiquitin ligase

PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d1umha1:

Sequence; same for both SEQRES and ATOM records:

>d1umha1 b.18.1.21 (A:117-297) F-box only protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
fyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfass
fewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvla
efatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwve
p

Timeline for d1umha1:

• d1umha1 first appeared in SCOP 1.67, called d1umha_
  
• d1umha1 was called d1umha_ in SCOPe 2.05
  
• d1umha1 appears in SCOPe 2.07
  
• d1umha1 appears in the current release, SCOPe 2.08