SCOP 1.75: Domain d1uj1b_: 1uj1 B:

Lineage for d1uj1b_ (1uj1 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (20 PDB entries)

8. Domain d1uj1b_: 1uj1 B: [99451]

Details for d1uj1b_

PDB Entry: 1uj1, 1.9 Å

PDB Description: Crystal structure of SARS Coronavirus Main Proteinase (3CLpro)

PDB Compounds: (B:) 3C-like proteinase

SCOP Domain Sequences for d1uj1b_:

Sequence; same for both SEQRES and ATOM records:

>d1uj1b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sg

Timeline for d1uj1b_:

• d1uj1b_ first appeared in SCOP 1.67
  
• d1uj1b_ appears in SCOP 1.73
  
• d1uj1b_ appears in SCOPe 2.01
  
• d1uj1b_ appears in the current release, SCOPe 2.08