Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.27: Hypothetical protein TT1662 [102616] (1 protein) |
Protein Hypothetical protein TT1662 [102617] (1 species) |
Species Thermus thermophilus [TaxId:274] [102618] (1 PDB entry) |
Domain d1ufof_: 1ufo F: [99349] structural genomics |
PDB Entry: 1ufo (more details), 1.6 Å
SCOPe Domain Sequences for d1ufof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufof_ c.69.1.27 (F:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} mrvrterltlaglsvlaripeapkalllalhglqgskehilallpgyaergflllafdap rhgeregpppsskspryveevyrvalgfkeearrvaeeaerrfglplflaggslgafvah lllaegfrprgvlafigsgfpmklpqgqvvedpgvlalyqappatrgeayggvpllhlhg srdhivplarmektlealrphypegrlarfveegaghtltplmarvglaflehwlear
Timeline for d1ufof_: