Lineage for d1ufoc_ (1ufo C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178944Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1178945Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1180373Family c.69.1.27: Hypothetical protein TT1662 [102616] (1 protein)
  6. 1180374Protein Hypothetical protein TT1662 [102617] (1 species)
  7. 1180375Species Thermus thermophilus [TaxId:274] [102618] (1 PDB entry)
  8. 1180378Domain d1ufoc_: 1ufo C: [99346]
    structural genomics

Details for d1ufoc_

PDB Entry: 1ufo (more details), 1.6 Å

PDB Description: Crystal Structure of TT1662 from Thermus thermophilus
PDB Compounds: (C:) hypothetical protein TT1662

SCOPe Domain Sequences for d1ufoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufoc_ c.69.1.27 (C:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}
mrvrterltlaglsvlaripeapkalllalhglqgskehilallpgyaergflllafdap
rhgeregpppsskspryveevyrvalgfkeearrvaeeaerrfglplflaggslgafvah
lllaegfrprgvlafigsgfpmklpqgqvvedpgvlalyqappatrgeayggvpllhlhg
srdhivplarmektlealrphypegrlarfveegaghtltplmarvglaflehwlear

SCOPe Domain Coordinates for d1ufoc_:

Click to download the PDB-style file with coordinates for d1ufoc_.
(The format of our PDB-style files is described here.)

Timeline for d1ufoc_: