Lineage for d1uena_ (1uen A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366660Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 366661Family b.1.2.1: Fibronectin type III [49266] (22 proteins)
  6. 366845Protein KIAA0343 protein [101531] (1 species)
  7. 366846Species Human (Homo sapiens) [TaxId:9606] [101532] (2 PDB entries)
  8. 366847Domain d1uena_: 1uen A: [99268]
    structural genomics; third Fn3 module

Details for d1uena_

PDB Entry: 1uen (more details)

PDB Description: solution structure of the third fibronectin iii domain of human kiaa0343 protein

SCOP Domain Sequences for d1uena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens)}
gssgssghsgedlpmvapgnvrvnvvnstlaevhwdpvplksirghlqgyriyywktqss
skrnrrhiekkiltfqgskthgmlpglepfshytlnvrvvngkgegpaspdrvfntpegs
gpssg

SCOP Domain Coordinates for d1uena_:

Click to download the PDB-style file with coordinates for d1uena_.
(The format of our PDB-style files is described here.)

Timeline for d1uena_: