Lineage for d1uena_ (1uen A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (24 proteins) 
Protein KIAA0343 protein [101531] (1 species) Species Human (Homo sapiens) [TaxId:9606] [101532] (2 PDB entries) 
Domain d1uena_: 1uen A: [99268]
structural genomics; third Fn3 module
Details for d1uena_
PDB Entry: 1uen (more details)
PDB Description: solution structure of the third fibronectin iii domain of human kiaa0343 protein
SCOP Domain Sequences for d1uena_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens)}
gssgssghsgedlpmvapgnvrvnvvnstlaevhwdpvplksirghlqgyriyywktqss
skrnrrhiekkiltfqgskthgmlpglepfshytlnvrvvngkgegpaspdrvfntpegs
gpssg
SCOP Domain Coordinates for d1uena_:
Click to download the PDB-style file with coordinates for d1uena_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uena_:
- d1uena_ first appeared in SCOP 1.67
- d1uena_ appears in SCOP 1.71
- d1uena_ appears in the current release, SCOPe 2.08, called d1uena1
View in 3D