Lineage for d1ueha_ (1ueh A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166562Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2166563Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2166564Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 2166565Protein Undecaprenyl diphosphate synthase [64007] (3 species)
  7. 2166569Species Escherichia coli [TaxId:562] [64009] (16 PDB entries)
  8. 2166572Domain d1ueha_: 1ueh A: [99259]
    complexed with mg, oxn, so4, unl

Details for d1ueha_

PDB Entry: 1ueh (more details), 1.73 Å

PDB Description: E. coli undecaprenyl pyrophosphate synthase in complex with Triton X-100, magnesium and sulfate
PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d1ueha_:

Sequence, based on SEQRES records: (download)

>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records): (download)

>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsm
elfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyg
grwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfll
wqiayaelyftdvlwpdfdeqdfegalnafanre

SCOPe Domain Coordinates for d1ueha_:

Click to download the PDB-style file with coordinates for d1ueha_.
(The format of our PDB-style files is described here.)

Timeline for d1ueha_: