Lineage for d1ucva1 (1ucv A:8-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715506Protein Ephrin type-A receptor 8, C-terminal domain [101242] (1 species)
  7. 2715507Species Human (Homo sapiens) [TaxId:9606] [101243] (1 PDB entry)
  8. 2715508Domain d1ucva1: 1ucv A:8-75 [99191]
    Other proteins in same PDB: d1ucva2, d1ucva3

Details for d1ucva1

PDB Entry: 1ucv (more details)

PDB Description: sterile alpha motif (sam) domain of ephrin type-a receptor 8
PDB Compounds: (A:) ephrin type-a receptor 8

SCOPe Domain Sequences for d1ucva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucva1 a.60.1.2 (A:8-75) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ltvgdwldsirmgryrdhfaaggysslgmvlrmnaqdvralgitlmghqkkilgsiqtmr
aqltstqg

SCOPe Domain Coordinates for d1ucva1:

Click to download the PDB-style file with coordinates for d1ucva1.
(The format of our PDB-style files is described here.)

Timeline for d1ucva1: