Lineage for d1uawa_ (1uaw A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028068Protein Musashi-1 [102981] (1 species)
  7. 1028069Species Mouse (Mus musculus) [TaxId:10090] [102982] (1 PDB entry)
  8. 1028070Domain d1uawa_: 1uaw A: [99139]

Details for d1uawa_

PDB Entry: 1uaw (more details)

PDB Description: solution structure of the n-terminal rna-binding domain of mouse musashi1
PDB Compounds: (A:) mouse-musashi-1

SCOPe Domain Sequences for d1uawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}
ckmfigglswqttqeglreyfgqfgevkeclvmrdpltkrsrgfgfvtfmdqagvdkvla
qsrheldsktidpkvaf

SCOPe Domain Coordinates for d1uawa_:

Click to download the PDB-style file with coordinates for d1uawa_.
(The format of our PDB-style files is described here.)

Timeline for d1uawa_: