Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Dephospho-CoA kinase [75187] (3 species) |
Species Escherichia coli [TaxId:562] [82394] (5 PDB entries) |
Domain d1t3hc_: 1t3h C: [99119] structural genomics; NESG target ER57 complexed with so4 |
PDB Entry: 1t3h (more details), 2.5 Å
SCOP Domain Sequences for d1t3hc_:
Sequence, based on SEQRES records: (download)
>d1t3hc_ c.37.1.1 (C:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd aiasdvarlhahylqlasqfvsqekpe
>d1t3hc_ c.37.1.1 (C:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmee knwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetqlkr tmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlasqf vsqekpe
Timeline for d1t3hc_: