Lineage for d1sqsb_ (1sqs B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838839Family c.23.5.5: Hypothetical protein SP1951 [102234] (2 proteins)
  6. 1838840Protein Hypothetical protein SP1951 [102235] (1 species)
  7. 1838841Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [102236] (1 PDB entry)
  8. 1838843Domain d1sqsb_: 1sqs B: [98969]
    structural genomics; NESG target SPR27
    complexed with tla

Details for d1sqsb_

PDB Entry: 1sqs (more details), 1.5 Å

PDB Description: x-ray crystal structure protein sp1951 of streptococcus pneumoniae. northeast structural genomics consortium target spr27.
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1sqsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqsb_ c.23.5.5 (B:) Hypothetical protein SP1951 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyven

SCOPe Domain Coordinates for d1sqsb_:

Click to download the PDB-style file with coordinates for d1sqsb_.
(The format of our PDB-style files is described here.)

Timeline for d1sqsb_: