Lineage for d1sq6a_ (1sq6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2140830Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2141229Protein Putative uridine phosphorylase [102500] (1 species)
  7. 2141230Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102501] (3 PDB entries)
  8. 2141243Domain d1sq6a_: 1sq6 A: [98964]
    complexed with so4

Details for d1sq6a_

PDB Entry: 1sq6 (more details), 2.4 Å

PDB Description: Plasmodium falciparum homolog of Uridine phosphorylase/Purine nucleoside phosphorylase
PDB Compounds: (A:) Uridine phosphorylase, putative

SCOPe Domain Sequences for d1sq6a_:

Sequence, based on SEQRES records: (download)

>d1sq6a_ c.56.2.1 (A:) Putative uridine phosphorylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
llrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcvs
hgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshllih
gdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavvem
elatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklatk
y

Sequence, based on observed residues (ATOM records): (download)

>d1sq6a_ c.56.2.1 (A:) Putative uridine phosphorylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
llrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcvs
hgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshllih
gdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavvem
elatlmvigtlrkvktggilivdghqlenmikialgacaklatky

SCOPe Domain Coordinates for d1sq6a_:

Click to download the PDB-style file with coordinates for d1sq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1sq6a_: