Lineage for d1s8af_ (1s8a F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859610Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 2859611Protein Methylglyoxal synthase, MgsA [52340] (3 species)
  7. 2859612Species Escherichia coli [TaxId:562] [52341] (5 PDB entries)
  8. 2859633Domain d1s8af_: 1s8a F: [98732]
    complexed with pga; mutant

Details for d1s8af_

PDB Entry: 1s8a (more details), 2.2 Å

PDB Description: h98q mutant of methylglyoxal synthase from e. coli complexed with phosphoglycolic acid
PDB Compounds: (F:) methylglyoxal synthase

SCOPe Domain Sequences for d1s8af_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8af_ c.24.1.2 (F:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]}
melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv
namlsgpmggdqqvgalisegkidvliffwdplnavpqdpdvkallrlatvwnipvatnv
atadfiiqsphfndavdilipdyqryladrlk

SCOPe Domain Coordinates for d1s8af_:

Click to download the PDB-style file with coordinates for d1s8af_.
(The format of our PDB-style files is described here.)

Timeline for d1s8af_: