Lineage for d1s5ma_ (1s5m A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1345125Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1345176Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1345177Protein D-xylose isomerase [51666] (13 species)
  7. 1345289Species Streptomyces olivochromogenes [TaxId:1963] [51669] (9 PDB entries)
  8. 1345292Domain d1s5ma_: 1s5m A: [98565]
    complexed with glc, mn, na

Details for d1s5ma_

PDB Entry: 1s5m (more details), 0.98 Å

PDB Description: xylose isomerase in substrate and inhibitor michaelis states: atomic resolution studies of a metal-mediated hydride shift
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d1s5ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ma_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]}
syqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipf
gssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwa
saagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfd
vdaaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d1s5ma_:

Click to download the PDB-style file with coordinates for d1s5ma_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ma_: