Lineage for d1s5ma_ (1s5m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839096Protein D-xylose isomerase [51666] (13 species)
  7. 2839208Species Streptomyces olivochromogenes [TaxId:1963] [51669] (9 PDB entries)
  8. 2839211Domain d1s5ma_: 1s5m A: [98565]
    complexed with glc, mn, na

Details for d1s5ma_

PDB Entry: 1s5m (more details), 0.98 Å

PDB Description: xylose isomerase in substrate and inhibitor michaelis states: atomic resolution studies of a metal-mediated hydride shift
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d1s5ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ma_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]}
syqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipf
gssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwa
saagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfd
vdaaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d1s5ma_:

Click to download the PDB-style file with coordinates for d1s5ma_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ma_: