Lineage for d1s5bg_ (1s5b G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1787829Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1787830Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 1787831Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 1787921Domain d1s5bg_: 1s5b G: [98533]
    Other proteins in same PDB: d1s5ba_
    complexed with na; mutant

Details for d1s5bg_

PDB Entry: 1s5b (more details), 2.13 Å

PDB Description: cholera holotoxin with an a-subunit y30s mutation form 3
PDB Compounds: (G:) cholera toxin B protein (CTB)

SCOPe Domain Sequences for d1s5bg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5bg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1s5bg_:

Click to download the PDB-style file with coordinates for d1s5bg_.
(The format of our PDB-style files is described here.)

Timeline for d1s5bg_: