SCOPe 2.02: Domain d1s2gb_: 1s2g B:

Lineage for d1s2gb_ (1s2g B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)

6. Protein Purine transdeoxyribosylase [102244] (1 species)
   class I N-deoxyribosyltransferase

7. Species Lactobacillus helveticus [TaxId:1587] [102245] (5 PDB entries)

8. Domain d1s2gb_: 1s2g B: [98383]
   complexed with 3d1

Details for d1s2gb_

PDB Entry: 1s2g, 2.1 Å

PDB Description: Purine 2'deoxyribosyltransferase + 2'-deoxyadenosine

PDB Compounds: (B:) purine trans deoxyribosylase

SCOPe Domain Sequences for d1s2gb_:

Sequence; same for both SEQRES and ATOM records:

>d1s2gb_ c.23.14.1 (B:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]}
mkavvptgkiylgspfysdaqreraakakellaknpsiahvffpfddgftdpdeknpeig
girsmvwrdatyqndltgisnatcgvflydmdqlddgsafeigfmramhkpvilvpfteh
pekekkmnlmiaqgvttiidgntefekladynfnecpsnpvrgygiy

Timeline for d1s2gb_:

• d1s2gb_ first appeared in SCOP 1.67
  
• d1s2gb_ appears in SCOPe 2.01
  
• d1s2gb_ appears in SCOPe 2.03
  
• d1s2gb_ appears in the current release, SCOPe 2.08