Lineage for d1s0ua3 (1s0u A:34-229)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 393949Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (2 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83
  7. 393950Species Archaeon Methanococcus jannaschii [TaxId:2190] [102365] (1 PDB entry)
  8. 393951Domain d1s0ua3: 1s0u A:34-229 [98304]
    Other proteins in same PDB: d1s0ua1, d1s0ua2
    structural genomics
    complexed with zn

Details for d1s0ua3

PDB Entry: 1s0u (more details), 2.4 Å

PDB Description: eif2gamma apo

SCOP Domain Sequences for d1s0ua3:

Sequence, based on SEQRES records: (download)

>d1s0ua3 c.37.1.8 (A:34-229) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Methanococcus jannaschii}
sqaevnigmvghvdhgktsltkaltgvwtdrhseelrrgisirlgyadceirkcpqcgty
ttkprcpnclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtk
ehlmaleilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipisahhean
idvllkaiqdfiptpk

Sequence, based on observed residues (ATOM records): (download)

>d1s0ua3 c.37.1.8 (A:34-229) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Methanococcus jannaschii}
sqaevnigmvghvdhgktsltkaltgvwtdrgisirlgyadceirkcpqcgtyttkprcp
nclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtkehlmale
ilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipinidvllkaiqdfip
tpk

SCOP Domain Coordinates for d1s0ua3:

Click to download the PDB-style file with coordinates for d1s0ua3.
(The format of our PDB-style files is described here.)

Timeline for d1s0ua3: