![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (43 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (2 species) includes rubredoxin-like zinc finger insert domain, res. 56-83 |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [102365] (1 PDB entry) |
![]() | Domain d1s0ua3: 1s0u A:34-229 [98304] Other proteins in same PDB: d1s0ua1, d1s0ua2 structural genomics |
PDB Entry: 1s0u (more details), 2.4 Å
SCOP Domain Sequences for d1s0ua3:
Sequence, based on SEQRES records: (download)
>d1s0ua3 c.37.1.8 (A:34-229) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Methanococcus jannaschii} sqaevnigmvghvdhgktsltkaltgvwtdrhseelrrgisirlgyadceirkcpqcgty ttkprcpnclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtk ehlmaleilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipisahhean idvllkaiqdfiptpk
>d1s0ua3 c.37.1.8 (A:34-229) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Methanococcus jannaschii} sqaevnigmvghvdhgktsltkaltgvwtdrgisirlgyadceirkcpqcgtyttkprcp nclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtkehlmale ilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipinidvllkaiqdfip tpk
Timeline for d1s0ua3: