Lineage for d1s0ua1 (1s0u A:230-347)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062785Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 2062786Species Methanococcus jannaschii [TaxId:2190] [101788] (1 PDB entry)
  8. 2062787Domain d1s0ua1: 1s0u A:230-347 [98302]
    Other proteins in same PDB: d1s0ua2, d1s0ua3, d1s0ua4
    structural genomics
    complexed with zn

Details for d1s0ua1

PDB Entry: 1s0u (more details), 2.4 Å

PDB Description: eif2gamma apo
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d1s0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Methanococcus jannaschii [TaxId: 2190]}
rdpdatprmyvarsfdinkpgteikdlkggvlggaiiqgvfkvgdeieirpgikvtegnk
tfwkplttkivslaagntilrkahpggligvgttldpyltksdaltgsvvglpgtlpp

SCOPe Domain Coordinates for d1s0ua1:

Click to download the PDB-style file with coordinates for d1s0ua1.
(The format of our PDB-style files is described here.)

Timeline for d1s0ua1: