![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [101788] (1 PDB entry) |
![]() | Domain d1s0ua1: 1s0u A:230-347 [98302] Other proteins in same PDB: d1s0ua2, d1s0ua3, d1s0ua4 structural genomics complexed with zn |
PDB Entry: 1s0u (more details), 2.4 Å
SCOPe Domain Sequences for d1s0ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Methanococcus jannaschii [TaxId: 2190]} rdpdatprmyvarsfdinkpgteikdlkggvlggaiiqgvfkvgdeieirpgikvtegnk tfwkplttkivslaagntilrkahpggligvgttldpyltksdaltgsvvglpgtlpp
Timeline for d1s0ua1: