![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (5 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
![]() | Protein Histidine triad nucleotide-binding protein (HINT) [54199] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54200] (9 PDB entries) |
![]() | Domain d1rzya_: 1rzy A: [98237] complexed with 5as |
PDB Entry: 1rzy (more details), 1.8 Å
SCOPe Domain Sequences for d1rzya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzya_ d.13.1.1 (A:) Histidine triad nucleotide-binding protein (HINT) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} pggdtifgkiirkeipakiifeddqclafhdispqapthflvipkkhisqisaaedades llghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg
Timeline for d1rzya_: