Class b: All beta proteins [48724] (177 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins) automatically mapped to Pfam PF02278 |
Protein Chondroitinase AC [50007] (2 species) |
Species Arthrobacter aurescens [TaxId:43663] [101660] (6 PDB entries) |
Domain d1rwca3: 1rwc A:373-644 [97976] Other proteins in same PDB: d1rwca1, d1rwca2 complexed with gol, na, po4 |
PDB Entry: 1rwc (more details), 1.9 Å
SCOPe Domain Sequences for d1rwca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rwca3 b.30.5.2 (A:373-644) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]} atghklfpamdrtmhrgpgwalslalssnriawyecgngennrgyhtgsgmtyfytsdlg qyddafwatanynrlpgitvdttplpdkvegqwgaavpadewsgatalgevaavgqhlvg pgrtgltarkswfvsgdvtvclgadistasgakvetivdhrnlhqgsntlttaagtiagt agtvevlgdgrwvhlegfggyamlddsplhvlretrsgswsgvningsatvqqrnfatly vnhgvgpvagsyaymvapgasvdltrkllegn
Timeline for d1rwca3: