Lineage for d1rrsa2 (1rrs A:234-360)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1038513Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1038514Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1038725Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)
  6. 1038729Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)
  7. 1038730Species Bacillus stearothermophilus [TaxId:1422] [103213] (3 PDB entries)
  8. 1038732Domain d1rrsa2: 1rrs A:234-360 [97801]
    Other proteins in same PDB: d1rrsa1
    protein/DNA complex; complexed with ca, sf4

Details for d1rrsa2

PDB Entry: 1rrs (more details), 2.4 Å

PDB Description: MutY adenine glycosylase in complex with DNA containing an abasic site
PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1rrsa2:

Sequence, based on SEQRES records: (download)

>d1rrsa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq
veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr
eykewas

Sequence, based on observed residues (ATOM records): (download)

>d1rrsa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvglqvelt
epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
was

SCOPe Domain Coordinates for d1rrsa2:

Click to download the PDB-style file with coordinates for d1rrsa2.
(The format of our PDB-style files is described here.)

Timeline for d1rrsa2: