Lineage for d1rqib_ (1rqi B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924604Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 924605Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 924606Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 924607Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)
  7. 924614Species Escherichia coli [TaxId:562] [101453] (2 PDB entries)
  8. 924618Domain d1rqib_: 1rqi B: [97743]
    complexed with dpo, dst, ipr, mg

Details for d1rqib_

PDB Entry: 1rqi (more details), 2.42 Å

PDB Description: active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and dimethylallyl s-thiolodiphosphate
PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d1rqib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqib_ a.128.1.1 (B:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]}
dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv
stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla
fsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk
tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqga
dqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk

SCOPe Domain Coordinates for d1rqib_:

Click to download the PDB-style file with coordinates for d1rqib_.
(The format of our PDB-style files is described here.)

Timeline for d1rqib_: