Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Matrix metalloproteinase-16 (MMP-16) [103130] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103131] (1 PDB entry) |
Domain d1rm8a_: 1rm8 A: [97660] complexed with bat, ca, zn |
PDB Entry: 1rm8 (more details), 1.8 Å
SCOPe Domain Sequences for d1rm8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} gqkwqhkhitysiknvtpkvgdpetrkairrafdvwqnvtpltfeevpyselengkrdvd itiifasgfhgdsspfdgeggflahayfpgpgiggdthfdsdepwtlgnpnhdgndlflv avhelghalglehsndptaimapfyqymetdnfklpnddlqgiqkiygp
Timeline for d1rm8a_: