Lineage for d1rm8a_ (1rm8 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034832Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1035007Protein Matrix metalloproteinase-16 (MMP-16) [103130] (1 species)
  7. 1035008Species Human (Homo sapiens) [TaxId:9606] [103131] (1 PDB entry)
  8. 1035009Domain d1rm8a_: 1rm8 A: [97660]
    complexed with bat, ca, zn

Details for d1rm8a_

PDB Entry: 1rm8 (more details), 1.8 Å

PDB Description: crystal structure of the catalytic domain of mmp-16/mt3-mmp: characterization of mt-mmp specific features
PDB Compounds: (A:) Matrix metalloproteinase-16

SCOPe Domain Sequences for d1rm8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]}
gqkwqhkhitysiknvtpkvgdpetrkairrafdvwqnvtpltfeevpyselengkrdvd
itiifasgfhgdsspfdgeggflahayfpgpgiggdthfdsdepwtlgnpnhdgndlflv
avhelghalglehsndptaimapfyqymetdnfklpnddlqgiqkiygp

SCOPe Domain Coordinates for d1rm8a_:

Click to download the PDB-style file with coordinates for d1rm8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rm8a_: