Lineage for d1rjwb1 (1rjw B:1-137,B:306-339)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785402Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1785403Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1785524Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1785545Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1785549Species Bacillus stearothermophilus [TaxId:1422] [101703] (1 PDB entry)
  8. 1785551Domain d1rjwb1: 1rjw B:1-137,B:306-339 [97584]
    Other proteins in same PDB: d1rjwa2, d1rjwb2, d1rjwc2, d1rjwd2
    complexed with etf, zn

Details for d1rjwb1

PDB Entry: 1rjw (more details), 2.35 Å

PDB Description: crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r
PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1rjwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjwb1 b.35.1.2 (B:1-137,B:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg
hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy
aeycraaadyvvkipdnXtiievqplekinevfdrmlkgqingrvvltledk

SCOPe Domain Coordinates for d1rjwb1:

Click to download the PDB-style file with coordinates for d1rjwb1.
(The format of our PDB-style files is described here.)

Timeline for d1rjwb1: