Lineage for d1rerb2 (1rer B:1-292)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237205Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 1237206Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 1237207Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)
  6. 1237233Protein Fusion glycoprotein E1 [75656] (1 species)
  7. 1237234Species Semliki forest virus [TaxId:11033] [75657] (3 PDB entries)
  8. 1237237Domain d1rerb2: 1rer B:1-292 [97330]
    Other proteins in same PDB: d1rera1, d1rerb1, d1rerc1
    complexed with br, ho, po4

Details for d1rerb2

PDB Entry: 1rer (more details), 3.2 Å

PDB Description: crystal structure of the homotrimer of fusion glycoprotein e1 from semliki forest virus.
PDB Compounds: (B:) Structural polyprotein

SCOPe Domain Sequences for d1rerb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rerb2 f.10.1.1 (B:1-292) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive

SCOPe Domain Coordinates for d1rerb2:

Click to download the PDB-style file with coordinates for d1rerb2.
(The format of our PDB-style files is described here.)

Timeline for d1rerb2: