Lineage for d1r7ab1 (1r7a B:435-504)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077281Protein Sucrose phosphorylase [101920] (1 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 2077282Species Bifidobacterium adolescentis [TaxId:1680] [101921] (2 PDB entries)
  8. 2077284Domain d1r7ab1: 1r7a B:435-504 [97194]
    Other proteins in same PDB: d1r7aa2, d1r7ab2
    complexed with trs

Details for d1r7ab1

PDB Entry: 1r7a (more details), 1.77 Å

PDB Description: Sucrose Phosphorylase from Bifidobacterium adolescentis
PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d1r7ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ab1 b.71.1.1 (B:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

SCOPe Domain Coordinates for d1r7ab1:

Click to download the PDB-style file with coordinates for d1r7ab1.
(The format of our PDB-style files is described here.)

Timeline for d1r7ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r7ab2