Lineage for d1r3ih2 (1r3i H:119-219)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549334Domain d1r3ih2: 1r3i H:119-219 [96925]
    Other proteins in same PDB: d1r3ic_, d1r3ih1, d1r3il1, d1r3il2
    part of Fab against potassium channel KcsA
    complexed with dga, f09, rb; mutant

Details for d1r3ih2

PDB Entry: 1r3i (more details), 2.4 Å

PDB Description: potassium channel kcsa-fab complex in rb+

SCOP Domain Sequences for d1r3ih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ih2 b.1.1.2 (H:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1r3ih2:

Click to download the PDB-style file with coordinates for d1r3ih2.
(The format of our PDB-style files is described here.)

Timeline for d1r3ih2: