Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
Domain d1r3ih2: 1r3i H:119-219 [96925] Other proteins in same PDB: d1r3ic_, d1r3ih1, d1r3il1, d1r3il2 part of Fab against potassium channel KcsA complexed with dga, f09, rb; mutant |
PDB Entry: 1r3i (more details), 2.4 Å
SCOP Domain Sequences for d1r3ih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3ih2 b.1.1.2 (H:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
Timeline for d1r3ih2: