Lineage for d1r00a1 (1r00 A:10-101)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722271Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
    unknown function
  6. 1722272Protein Aclacinomycin-10-hydroxylase RdmB [101035] (1 species)
    evolved a different function; binds SAM and SAH
  7. 1722273Species Streptomyces purpurascens [TaxId:1924] [101036] (4 PDB entries)
    Uniprot Q54527
  8. 1722275Domain d1r00a1: 1r00 A:10-101 [96721]
    Other proteins in same PDB: d1r00a2
    complexed with act, sah

Details for d1r00a1

PDB Entry: 1r00 (more details), 2.5 Å

PDB Description: crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
PDB Compounds: (A:) aclacinomycin-10-hydroxylase

SCOPe Domain Sequences for d1r00a1:

Sequence, based on SEQRES records: (download)

>d1r00a1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekqgrplrptrlgmlladg

Sequence, based on observed residues (ATOM records): (download)

>d1r00a1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekgrplrptrlgmlladg

SCOPe Domain Coordinates for d1r00a1:

Click to download the PDB-style file with coordinates for d1r00a1.
(The format of our PDB-style files is described here.)

Timeline for d1r00a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r00a2