Lineage for d1qzvf_ (1qzv F:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1070931Fold i.5: Photosystems [58155] (1 superfamily)
  4. 1070932Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 1070933Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. Protein Plant photosystem I [103667] (1 species)
  7. Species Pea (Pisum sativum) [TaxId:3888] [103668] (1 PDB entry)
  8. 1071045Domain d1qzvf_: 1qzv F: [96682]
    complexed with cl1, pqn, sf4

Details for d1qzvf_

PDB Entry: 1qzv (more details), 4.44 Å

PDB Description: Crystal structure of plant photosystem I
PDB Compounds: (F:) plant photosystem I: subunit psaf

SCOPe Domain Sequences for d1qzvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzvf_ i.5.1.1 (F:) Plant photosystem I {Pea (Pisum sativum) [TaxId: 3888]}
xxxxxxxxxxxxxxxxxekqalkklqaslklyaddsapalaikatmexxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SCOPe Domain Coordinates for d1qzvf_:

Click to download the PDB-style file with coordinates for d1qzvf_.
(The format of our PDB-style files is described here.)

Timeline for d1qzvf_: