Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein PII (product of glnB) [54915] (7 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (2 PDB entries) |
Domain d1qy7b_: 1qy7 B: [96576] complexed with ni, so4 |
PDB Entry: 1qy7 (more details), 2 Å
SCOPe Domain Sequences for d1qy7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qy7b_ d.58.5.1 (B:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
Timeline for d1qy7b_: