SCOPe 2.02: Domain d1qvyc_: 1qvy C:

Lineage for d1qvyc_ (1qvy C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries)

8. Domain d1qvyc_: 1qvy C: [96451]
   complexed with so4; mutant

Details for d1qvyc_

PDB Entry: 1qvy, 1.6 Å

PDB Description: crystal structure of rhogdi k(199,200)r double mutant

PDB Compounds: (C:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1qvyc_:

Sequence; same for both SEQRES and ATOM records:

>d1qvyc_ b.1.18.8 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltirrdwkd

Timeline for d1qvyc_:

• d1qvyc_ first appeared in SCOP 1.67
  
• d1qvyc_ appears in SCOPe 2.01
  
• d1qvyc_ appears in SCOPe 2.03
  
• d1qvyc_ appears in the current release, SCOPe 2.08