Class a: All alpha proteins [46456] (290 folds) |
Fold a.174: Double Clp-N motif [81922] (1 superfamily) multihelical; array |
Superfamily a.174.1: Double Clp-N motif [81923] (2 families) duplication: contains two structural repeats of 4-helical motif |
Family a.174.1.1: Double Clp-N motif [81924] (3 proteins) |
Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species) |
Species Thermus thermophilus [TaxId:274] [101471] (1 PDB entry) |
Domain d1qvrb1: 1qvr B:4-148 [96435] Other proteins in same PDB: d1qvra2, d1qvra3, d1qvrb2, d1qvrb3, d1qvrc2, d1qvrc3 complexed with anp, pt |
PDB Entry: 1qvr (more details), 3 Å
SCOPe Domain Sequences for d1qvrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvrb1 a.174.1.1 (B:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} erwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkalkel qerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatpglp glealkgalkelrggrtvqtehaes
Timeline for d1qvrb1: