SCOPe 2.08: Domain d1q7ra1: 1q7r A:1-196

Lineage for d1q7ra1 (1q7r A:1-196)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Hypothetical protein YaaE [102250] (4 species)
   glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis

7. Species Bacillus stearothermophilus [TaxId:1422] [102252] (1 PDB entry)

8. Domain d1q7ra1: 1q7r A:1-196 [96054]
   Other proteins in same PDB: d1q7ra2
   structural genomics
   complexed with cl, edo, so4

Details for d1q7ra1

PDB Entry: 1q7r, 1.9 Å

PDB Description: X-ray crystallographic analysis of a predicted amidotransferase from B. stearothermophilus at 1.9 A resolution

PDB Compounds: (A:) predicted amidotransferase

SCOPe Domain Sequences for d1q7ra1:

Sequence; same for both SEQRES and ATOM records:

>d1q7ra1 c.23.16.1 (A:1-196) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]}
mkigvlglqgavrehvraieacgaeavivkkseqlegldglvlpggesttmrrlidrygl
meplkqfaaagkpmfgtcaglillakrivgydephlglmditvernsfgrqresfeaels
ikgvgdgfvgvfiraphiveagdgvdvlatyndrivaarqgqflgcsfhpeltddhrlmq
yflnmvkeakmasslk

Timeline for d1q7ra1:

• d1q7ra1 first appeared in SCOP 1.67, called d1q7ra_
  
• d1q7ra1 appears in SCOPe 2.07