Lineage for d1q6ya1 (1q6y A:4-418)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922183Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2922184Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2922185Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 2922242Protein Hypothetical protein YfdW [102709] (1 species)
  7. 2922243Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)
  8. 2922251Domain d1q6ya1: 1q6y A:4-418 [96012]
    Other proteins in same PDB: d1q6ya2, d1q6ya3
    structural genomics
    complexed with coa, mpd

Details for d1q6ya1

PDB Entry: 1q6y (more details), 1.99 Å

PDB Description: hypothetical protein yfdw from e. coli bound to coenzyme a
PDB Compounds: (A:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1q6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6ya1 c.123.1.1 (A:4-418) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
stplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyft
mlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlif
gsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligll
aallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavpr
ggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystahar
qphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveq
plrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

SCOPe Domain Coordinates for d1q6ya1:

Click to download the PDB-style file with coordinates for d1q6ya1.
(The format of our PDB-style files is described here.)

Timeline for d1q6ya1: