SCOP 1.75: Domain d1q4ea_: 1q4e A:

Lineage for d1q4ea_ (1q4e A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (2 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (5 proteins)

6. Protein Green fluorescent protein, GFP [54513] (2 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (53 PDB entries)
   Uniprot P42212

8. Domain d1q4ea_: 1q4e A: [95788]
   complexed with cro; mutant

Details for d1q4ea_

PDB Entry: 1q4e, 1.38 Å

PDB Description: s65t q80r y145c green fluorescent protein (gfp) ph 8.5

PDB Compounds: (A:) Green fluorescent protein

SCOP Domain Sequences for d1q4ea_:

Sequence; same for both SEQRES and ATOM records:

>d1q4ea_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleyncnshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

Timeline for d1q4ea_:

• d1q4ea_ first appeared in SCOP 1.67
  
• d1q4ea_ appears in SCOP 1.73
  
• d1q4ea_ appears in SCOPe 2.01
  
• d1q4ea_ appears in the current release, SCOPe 2.08