Lineage for d1q3ub2 (1q3u B:130-341)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681007Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1681008Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1681009Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 1681010Protein Cre recombinase [56355] (1 species)
  7. 1681011Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
    Uniprot P06956 20-341
  8. 1681041Domain d1q3ub2: 1q3u B:130-341 [95755]
    Other proteins in same PDB: d1q3ua1, d1q3ub1, d1q3ue1, d1q3uf1
    protein/DNA complex; complexed with iod, mg

Details for d1q3ub2

PDB Entry: 1q3u (more details), 2.9 Å

PDB Description: Crystal structure of a wild-type Cre recombinase-loxP synapse: pre-cleavage complex
PDB Compounds: (B:) cre recombinase

SCOPe Domain Sequences for d1q3ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ub2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOPe Domain Coordinates for d1q3ub2:

Click to download the PDB-style file with coordinates for d1q3ub2.
(The format of our PDB-style files is described here.)

Timeline for d1q3ub2: