Lineage for d1q3ub1 (1q3u B:20-129)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494115Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 1494116Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 1494117Protein Cre recombinase [47825] (1 species)
  7. 1494118Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
    Uniprot P06956 20-341
  8. 1494148Domain d1q3ub1: 1q3u B:20-129 [95754]
    Other proteins in same PDB: d1q3ua2, d1q3ub2, d1q3ue2, d1q3uf2
    protein/DNA complex; complexed with iod, mg

Details for d1q3ub1

PDB Entry: 1q3u (more details), 2.9 Å

PDB Description: Crystal structure of a wild-type Cre recombinase-loxP synapse: pre-cleavage complex
PDB Compounds: (B:) cre recombinase

SCOPe Domain Sequences for d1q3ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ub1 a.60.9.1 (B:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d1q3ub1:

Click to download the PDB-style file with coordinates for d1q3ub1.
(The format of our PDB-style files is described here.)

Timeline for d1q3ub1: