Lineage for d1q3rc3 (1q3r C:146-216,C:370-405)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026296Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 1026297Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 1026453Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)
  6. 1026454Protein Thermosome, I domain [54854] (3 species)
  7. 1026455Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries)
  8. 1026466Domain d1q3rc3: 1q3r C:146-216,C:370-405 [95724]
    Other proteins in same PDB: d1q3ra1, d1q3ra2, d1q3rb1, d1q3rb2, d1q3rc1, d1q3rc2, d1q3rd1, d1q3rd2
    complexed with so4; mutant

Details for d1q3rc3

PDB Entry: 1q3r (more details), 2.9 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (nucleotide-free form of single mutant)
PDB Compounds: (C:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q3rc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3rc3 d.56.1.2 (C:146-216,C:370-405) Thermosome, I domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk
agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg

SCOPe Domain Coordinates for d1q3rc3:

Click to download the PDB-style file with coordinates for d1q3rc3.
(The format of our PDB-style files is described here.)

Timeline for d1q3rc3: