Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Shank1, PDZ domain [101733] (1 species) SH3 and multiple ankyrin repeat domains protein 1 |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101734] (4 PDB entries) |
Domain d1q3oa_: 1q3o A: [95700] complexed with br |
PDB Entry: 1q3o (more details), 1.8 Å
SCOPe Domain Sequences for d1q3oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} dyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawrag lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrh
Timeline for d1q3oa_: