Lineage for d1q1bb1 (1q1b B:236-370)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060894Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2060978Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2060998Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2060999Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2061033Domain d1q1bb1: 1q1b B:236-370 [95564]
    Other proteins in same PDB: d1q1ba2, d1q1bb2, d1q1bc2, d1q1bd2

Details for d1q1bb1

PDB Entry: 1q1b (more details), 2.8 Å

PDB Description: Crystal structure of E. coli MalK in the nucleotide-free form
PDB Compounds: (B:) Maltose/maltodextrin transport ATP-binding protein malK

SCOPe Domain Sequences for d1q1bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1bb1 b.40.6.3 (B:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOPe Domain Coordinates for d1q1bb1:

Click to download the PDB-style file with coordinates for d1q1bb1.
(The format of our PDB-style files is described here.)

Timeline for d1q1bb1: